General Information

  • ID:  hor000178
  • Uniprot ID:  Q9NL55
  • Protein name:  CHH-like protein
  • Gene name:  CHHL
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Expressed in five or six cells (per hemisphere) in the frontal area of the brain in day 4 fifth instar larvae.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFFTLECKGVFDAAIFARLDRICDDCFNLFREPQLYTLCRAECFTTPYFKGCMESLYLYDEKEQIDQMIDFV
  • Length:  72(36-107)
  • Propeptide:  MHLSSVQFAWAALVALAVSAAGALPSSAPHHVERRSFFTLECKGVFDAAIFARLDRICDDCFNLFREPQLYTLCRAECFTTPYFKGCMESLYLYDEKEQIDQMIDFVGKR
  • Signal peptide:  MHLSSVQFAWAALVALAVSAAGA
  • Modification:  T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P07492-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P07492-F1.pdbhor000178_AF2.pdbhor000178_ESM.pdb

Physical Information

Mass: 984548 Formula: C388H575N91O113S8
Absent amino acids: HW Common amino acids: F
pI: 4.09 Basic residues: 7
Polar residues: 19 Hydrophobic residues: 26
Hydrophobicity: 1.94 Boman Index: -10861
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 73.19
Instability Index: 3725.28 Extinction Coefficient cystines: 6335
Absorbance 280nm: 89.23

Literature

  • PubMed ID:  10745158
  • Title:  Isolation of a cDNA Encoding a CHH-family Peptide From the Silkworm Bombyx Mori